PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn136031
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family MYB_related
Protein Properties Length: 222aa    MW: 25258.4 Da    PI: 6.8679
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn136031genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding551.9e-171055148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+ T++Ed+l+v+ +++lG++ W++Ia +++ gRt++++k++w+++l
       Achn136031 10 RGNITPDEDDLIVKMHALLGNR-WSLIAGRLP-GRTDNEIKNYWNTHL 55
                     7999******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.9E-25159IPR009057Homeodomain-like
SuperFamilySSF466891.05E-15163IPR009057Homeodomain-like
PROSITE profilePS5129426.151559IPR017930Myb domain
SMARTSM007174.0E-16957IPR001005SANT/Myb domain
PfamPF002492.0E-151055IPR001005SANT/Myb domain
CDDcd001671.87E-121455No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 222 aa     Download sequence    Send to blast
MNYLRPDIKR GNITPDEDDL IVKMHALLGN RWSLIAGRLP GRTDNEIKNY WNTHLTKKLR  60
SLGTDPTTHK KLSDSHVQEQ KMRKNSSKKK KPKPKPMPEA EPEKLKVHNP KPIRIKSLGS  120
FSMSRNTSFD WTTTTTTTTT TASGTEVADD PWSNFRYNEV GFLIGDDQDH DMINGSDLEC  180
HSGVPMSDHT LEKLYEEYLQ LLKAEDHDHV ELDSFAESLL I*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-1425951108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007051504.13e-87Myb domain protein 7, putative
TrEMBLA0A061DUF43e-87A0A061DUF4_THECC; Myb domain protein 7, putative
STRINGPOPTR_0002s17460.14e-75(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22640.15e-36myb domain protein 3